This is a working overview of Neurotrophic signalling, written for readers who want more than a one-paragraph summary but less than a textbook.
This page was last updated on 2026-06-08 and is reviewed periodically as new material appears.
Scientific literature on semax is unevenly distributed. A substantial share of published work originates from a small number of laboratories in Russia, while independent replication elsewhere is limited. Human data consist mostly of small trials with short follow-up, and several reported outcomes rely on subjective rating scales. Questions about how much intact peptide reaches the central nervous system after nasal administration, and how long it persists there, are still unresolved. The compound is best described as an active research subject rather than a settled pharmacological agent.
Semax is a synthetic heptapeptide with the sequence Met-Glu-His-Phe-Pro-Gly-Pro. It was derived from the ACTH(4-10) fragment, a short segment of adrenocorticotropic hormone that lacks the hormonal activity associated with the full-length peptide. Researchers at the Institute of Molecular Genetics in Moscow developed the compound during the 1980s. It has been registered as a pharmaceutical product in Russia and several neighbouring countries, where it is supplied as a nasal solution, and it is also sold internationally as a research chemical.
The proposed mechanism centres on neurotrophic signalling rather than direct receptor activation. Semax is reported to increase expression of brain-derived neurotrophic factor and nerve growth factor in several brain regions, and to shift the balance between excitatory and inhibitory neurotransmitter systems. Interaction with melanocortin receptors has been suggested because of the parent ACTH fragment. Many of these findings come from rodent studies, and the extent to which they translate to human physiology remains an open question.
Verification of a supplied batch generally combines a certificate of analysis with independent testing, because certificates are self-reported documents. A typical package includes a chromatographic trace, a mass spectrum, and a stated water or counter-ion content. Batch-to-batch consistency matters more than a single purity figure when results are compared across experiments. No single mandatory standard governs research-grade peptide release, so laboratories are expected to define their own acceptance criteria. Residual trifluoroacetate from purification is a frequently overlooked counter-ion.
Lyophilized material is chemically stable for extended periods when kept dry, cold, and protected from light. The powder is hygroscopic, so vials should be warmed to room temperature before opening to reduce condensation on the contents. Once dissolved, the peptide is far less stable because peptide bonds are susceptible to hydrolysis and the methionine residue can oxidize. Solutions are typically aliquoted and held at 2-8 °C for short intervals or frozen for longer ones, and repeated freeze-thaw cycles should be avoided.
| Property | Value | Notes |
|---|---|---|
| Molecular formula | C37H51N9O10S | Calculated for the free peptide |
| Molar mass | 813.9 g/mol | Anhydrous free base |
| Peptide class | Synthetic heptapeptide | ACTH(4-10) analogue |
| Parent fragment | ACTH(4-10) | Adrenocorticotropic hormone segment |
| Developmental origin | Institute of Molecular Genetics, Moscow | Work began in the 1980s |
The parent fragment ACTH(4-10) carries the sequence Met-Glu-His-Phe-Arg-Trp-Gly. Semax replaces the arginine and tryptophan positions with a proline-glycine-proline tail, giving Met-Glu-His-Phe-Pro-Gly-Pro. That change removes residues associated with adrenal stimulation, so the peptide does not drive cortisol release the way full ACTH does. This distinction shapes how the compound is grouped in the literature, where it sits with neuropeptides and peptide neuromodulators rather than with corticosteroids.
Regulatory status varies sharply by country. Semax is registered for medical use in Russia, where it appears in formularies as a nasal solution, and it also holds registration in a small number of neighbouring states. It has no approval from the United States Food and Drug Administration or the European Medicines Agency, and it is not a scheduled controlled substance in most jurisdictions. Elsewhere it circulates mainly as laboratory material, so purity documentation comes from suppliers rather than from a national pharmacopoeia.
Semax is a synthetic peptide created in the Soviet Union during the early 1980s by researchers working in Moscow. It was built from the short adrenocorticotropic hormone fragment known as ACTH(4-10), and the chain was then extended with three additional amino acids. The resulting molecule was named semax and entered clinical use in Russia in 1994. It is generally described as a nootropic and neuroprotective agent rather than as a hormone analogue.
Pharmacokinetic accounts emphasize rapid breakdown. After intravenous dosing the intact peptide disappears from blood within minutes, and nasal delivery produces low but measurable concentrations. Metabolites rather than the parent molecule may account for part of the observed activity, although the relative contribution is unresolved. Dosing in the literature varies widely and no optimal schedule has been agreed. These gaps are regularly cited as a reason the findings have not produced broad clinical adoption beyond the original research setting.
Proposed mechanisms center on neurotrophic signaling rather than on classical melanocortin receptor activation. Rodent experiments have reported shifts in the expression of brain-derived neurotrophic factor and nerve growth factor after administration, together with changes in the associated receptor systems. Several authors argue that the peptide acts largely through its degradation products and their interaction with peptidergic pathways, but this remains a hypothesis rather than a settled finding. No single molecular target has been identified in a way that the field broadly accepts.
ProIAPP consists of 67 amino acids, which follow a 22 amino acid signal peptide which is rapidly cleaved after translation of the 89 amino acid coding sequence. The human sequence (from N-terminus to C-terminus) is: (MGILKLQVFLIVLSVALNHLKA) TPIESHQVEKR^ KCNTATCATQRLANFLVHSSNNFGAILSSTNVGSNTYG^ KR^ NAVEVLKREPLNYLPL. The signal peptide is removed during translation of the protein and transport into the endoplasmic reticulum. Once inside the endoplasmic reticulum, a disulfide bond is formed between cysteine residues numbers 2 and 7. Later in the secretory pathway, the precursor undergoes additional proteolysis and posttranslational modification (indicated by ^). 11 amino acids are removed from the N-terminus by the enzyme proprotein convertase 2 (PC2) while 16 are removed from the C-terminus of the proIAPP molecule by proprotein convertase 1/3 (PC1/3). At the C-terminus Carboxypeptidase E then removes the terminal lysine and arginine residues. The terminal glycine amino acid that results from this cleavage allows the enzyme peptidylglycine alpha-amidating monooxygenase (PAM) to convert the terminal glycine to an amine group (releasing glycolate). After this step, the transformation from the precursor protein proIAPP to the biologically active IAPP (amylin) is complete (IAPP sequence: KCNTATCATQRLANFLVHSSNNFGAILSSTNVGSNTY-NH2).
In addition to killing bacteria directly they have been demonstrated to have a number of immunomodulatory functions that may be involved in the clearance of infection, including the ability to alter host gene expression, act as chemokines and/or induce chemokine production, inhibiting lipopolysaccharide induced pro-inflammatory cytokine production, promoting wound healing, and modulating the responses of dendritic cells and cells of the adaptive immune response. Animal models indicate that host defense peptides are crucial for both prevention and clearance of infection. It appears as though many peptides initially isolated as and termed "antimicrobial peptides" have been shown to have more significant alternative functions in vivo (e.g. hepcidin). Dusquetide for example is an immunomodulator that acts through p62, a protein involved in toll like receptor based signalling of infection. The peptide is being examined in a Phase III clinical trial by Soligenix (SGNX) to ascertain if it can assist in repair of radiation-induced damage to oral mucosa arising during cancer radiotherapy of the head and neck.
Three major forms of hCG are produced by humans, with each having distinct physiological roles. These include regular hCG, hyperglycosylated hCG, and the free beta-subunit of hCG. Degradation products of hCG have also been detected, including nicked hCG, hCG missing the C-terminal peptide from the beta-subunit, and free alpha-subunit, which has no known biological function. Some hCG is also made by the pituitary gland with a pattern of glycosylation that differs from placental forms of hCG. Regular hCG is the main form of hCG associated with the majority of pregnancy and in non-invasive molar pregnancies. This is produced in the trophoblast cells of the placental tissue. Hyperglycosylated hCG is the main form of hCG during the implantation phase of pregnancy, with invasive molar pregnancies, and with choriocarcinoma. Gonadotropin preparations of hCG can be produced for pharmaceutical use from animal or synthetic sources.
Life expectancy of people with acromegaly is dependent on how early the disease is detected. Life expectancy after the successful treatment of early disease is equal to that of the general population. Acromegaly can often go on for years before diagnosis, resulting in poorer outcome, and it is suggested that the better the growth hormone is controlled, the better the outcome. Upon successful surgical treatment, headaches and visual symptoms tend to resolve. One exception is sleep apnea, which is present in around 70% of cases but does not tend to resolve with successful treatment of growth hormone level. While hypertension is a complication of 40% of cases, it typically responds well to regular regimens of blood pressure medication. Diabetes that occurs with acromegaly is treated with the typical medications, but successful lowering of growth hormone levels often alleviates symptoms of diabetes. Hypogonadism without gonad destruction is reversible with treatment. Acromegaly is associated with a slightly elevated risk of cancer.
The ISOLDE facility contains the Class A laboratories, buildings for the HIE-ISOLDE and MEDICIS projects, and the control rooms located in building 508. Before ISOLDE, the radioactive nuclides were transported from the production are to the laboratory for examination. At ISOLDE, all processes from the production to the measurements are connected and the radioactive material requires no extra transport. Due to this, ISOLDE is referred to as an on-line facility. At the ISOLDE facility, the main proton beam for reactions comes from the PSB. The incoming proton beam has an energy of 1.4 GeV and its average intensity varies up to 2 μA. The beam enters the facility and is directed towards one of two mass separators: the General Purpose Separator (GPS) and the High Resolution Separator (HRS). The separators have independently run target-ion source systems, delivering 60 keV RIBs.
Sources: en.wikipedia.org
Passive or "adoptive transfer" of cell-mediated immunity, is conferred by the transfer of "sensitized" or activated T-cells from one individual into another. It is rarely used in humans because it requires histocompatible (matched) donors, which are often difficult to find. In unmatched donors this type of transfer carries severe risks of graft versus host disease. It has, however, been used to treat certain diseases including some types of cancer and immunodeficiency. This type of transfer differs from a bone marrow transplant, in which (undifferentiated) hematopoietic stem cells are transferred.
Since it is a protein universal to RNA-containing viruses, RdRp is a useful marker for understanding their evolution. The RdRP-bearing viruses are united into the taxon Orthornavirae. When replicating its (+)ssRNA genome, the poliovirus RdRp is able to carry out recombination. Recombination appears to occur by a copy choice mechanism in which the RdRp switches (+)ssRNA templates during negative strand synthesis. Recombination frequency is determined in part by the fidelity of RdRp replication. RdRp variants with high replication fidelity show reduced recombination, and low fidelity RdRps exhibit increased recombination. Recombination by RdRp strand switching occurs frequently during replication in the (+)ssRNA plant carmoviruses and tombusviruses.
In 1996, the US had about 2 deaths per 10,000 motor vehicles, compared to 1.9 in Germany, 2.6 in France, and 1.5 in the UK. In 1998, there were 3,421 fatal crashes in the UK, the fewest since 1926; in 2010, this number was further reduced to 1,857 and was attributed to the 2009–2010 scrappage scheme. The sizable traffic safety lead enjoyed by the US since the 1960s had narrowed significantly by 2002, with the US improvement percentages lagging in 16th place behind those of Australia, Austria, Canada, Denmark, Finland, Germany, United Kingdom, Iceland, Japan, Luxembourg, the Netherlands, New Zealand, Norway, Sweden, and Switzerland in terms of deaths per thousand vehicles, while in terms of deaths per 100 million vehicle miles travelled, the US had dropped from first place to tenth place. Transportation safety in the United States is monitored by various agencies.
2-Oleoylglycerol (2OG) is a monoacylglycerol that is found in biologic tissues. Its synthesis is derived from diacylglycerol precursors. It is metabolized to oleic acid and glycerol primarily by the enzyme monoacylglycerol lipase (MAGL). In 2011, 2OG was found to be an endogenous ligand to GPR119. 2OG has been shown to increase glucagon-like peptide-1 (GLP-1) and gastric inhibitory polypeptide (GIP) levels following administration to the small intestine. 2OG has also been discovered to potentiate G protein and not β-arrestin signaling via allosteric binding of the 5-HT2A receptor. 2-Arachidonoylglycerol JZL184
Sources: en.wikipedia.org
The book has generally been received well by the scientific community. According to Doty, those critical of the book range from people who refuse to read it to those who have semantic issues with the pheromone concept and its applicability to mammals. Peter Brennan argues that Doty does not consider some of the more recent scientific research that conflicts with his views. He cites a 2010 study in mice that reports the discovery of a urinary protein that attracts female mice. Brennan concludes: "I suspect that the majority of researchers will continue to use the term [pheromone], despite all of its shortcomings. But after reading this book, I will certainly be more circumspect when referring to pheromones in future."
The American Journal of Respiratory Cell and Molecular Biology is a monthly peer-reviewed medical journal and an official publication of the American Thoracic Society. It covers research on the structure and function of the respiratory system under physiologic and pathophysiologic conditions. It was established in July 1989. The founding editors-in-chief were Jerome S. Brody, Robert M. Senior, and Mary C. Williams. John A. Mcdonald served as editor from 1993 to 1998. Kenneth B. Adler (North Carolina State University) served as editor from 2009 to 2016. Paul Schumacker (Northwestern University) served as editor from October 1, 2016, to October 21, 2023. Andrew Halayko (University of Manitoba) assumed the editorship on November 1, 2023. The journal is abstracted and indexed in BIOSIS Previews, Current Contents/Life Sciences, Current Contents/Critical Care Medicine, Embase, Index Medicus/MEDLINE/PubMed, Science Citation Index Expanded, and Scopus. According to the Journal Citation Reports, the journal has a 2024 impact factor of 5.3. Official website
Issues facing plant breeding in the future include the lack of arable land, increasingly harsh cropping conditions and the need to maintain food security, which involves being able to provide the world population with sufficient nutrition. Crops need to be able to mature in multiple environments to allow worldwide access, which involves solving problems including drought tolerance. It has been suggested that global solutions are achievable through the process of plant breeding, with its ability to select specific genes allowing crops to perform at a level which yields the desired results. One issue facing agriculture is the loss of landraces and other local varieties which have diversity that may have useful genes for climate adaptation in the future. Conventional breeding intentionally limits phenotype plasticity within genotypes and limits variability between genotypes. Uniformity does not allow crops to adapt to climate change and other biotic stresses and abiotic stresses.
Treatments aiming to inhibit works to block specific caspases. Finally, the Akt protein kinase promotes cell survival through two pathways. Akt phosphorylates and inhibits Bad (a Bcl-2 family member), causing Bad to interact with the 14-3-3 scaffold, resulting in Bcl dissociation and thus cell survival. Akt also activates IKKα, which leads to NF-κB activation and cell survival. Active NF-κB induces the expression of anti-apoptotic genes such as Bcl-2, resulting in inhibition of apoptosis. NF-κB has been found to play both an antiapoptotic role and a proapoptotic role depending on the stimuli utilized and the cell type. The progression of the human immunodeficiency virus infection into AIDS is due primarily to the depletion of CD4+ T-helper lymphocytes in a manner that is too rapid for the body's bone marrow to replenish the cells, leading to a compromised immune system. One of the mechanisms by which T-helper cells are depleted is apoptosis, which results from a series of biochemical pathways:
In intrinsic termination, self-complementary sequences within the RNA transcript cause it to double back and form base pairs with itself, creating an RNA stem-loop or hairpin structure. This structure is critical for the release of both the transcript and polymerase at the end of transcription. In living cells, the key components are the stable stem-loop itself, as well as the sequence of 6–8 uracil residues that follow it. The stem usually consists of 8–9 mostly guanine and cytosine (G–C) base pairs, and the loop consists of 4–8 residues. It is thought that the stem portion of the structure is essential for transcription termination, while the loop is not. This is suggested by the fact that termination can be achieved in non-native structures that do not include the loop. The stem portion of the hairpin is usually rich in G–C base pairs. G–C base pairs have significant base-stacking interactions, and can form three hydrogen bonds with each other, which makes them very thermodynamically favorable. Conversely, while the uracil-rich sequence that follows the hairpin is not always necessary for termination, it is hypothesized that the uracil-rich sequence aids in intrinsic termination because the U–A bond is not as strong as G–C bonds. This inherent instability acts to kinetically favor the dissociation of the RNA transcript.
Sources: en.wikipedia.org
Semax is based on the ACTH(4-10) fragment, a seven-amino-acid segment of adrenocorticotropic hormone. The synthetic peptide retains the core sequence while removing regions associated with endocrine activity. This modification is intended to isolate effects on the nervous system.
It is registered for clinical use in Russia and a few other countries, typically as a nasal drop formulation. It does not hold approval from the United States Food and Drug Administration or the European Medicines Agency. Outside those markets it is generally handled as a research chemical.
The compound was developed in Moscow and the earliest studies were conducted there, so the primary literature is largely in Russian-language journals. Translation and indexing have been incomplete, which limits access for outside researchers. Independent groups have since published some work, but the total volume remains modest.
Dry powder is normally held at -20 °C or lower, away from light and moisture. Sealed vials can also be kept at 2-8 °C for shorter intervals. Warming to room temperature before opening prevents condensation.